TMEM146 anticorps (N-Term)

N° du produit ABIN635627

Détail du produit anti-TMEM146 anticorps

Antigène: TMEM146 (Transmembrane Protein 146 (TMEM146))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM146 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM146 antibody was raised against the N terminal of TMEM146

Purification: Affinity purified

Immunogène: TMEM146 antibody was raised using the N terminal of TMEM146 corresponding to a region with amino acids LIQDVQGDRLYFHPTTTRLIKHPCEKNIALYLGKQVFFTMDNFETSLLPF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM146 Blocking Peptide, catalog no. 33R-5061, is also available for use as a blocking control in assays to test for specificity of this TMEM146 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM146 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM146

Antigène: TMEM146 (Transmembrane Protein 146 (TMEM146))

Autre désignation: TMEM146 (TMEM146 Produits)

Synonymes: anticorps TMEM146, anticorps 4921529N20Rik, anticorps 4933402B14Rik, anticorps 619718, anticorps AW045609, anticorps Gm6095, anticorps Tmem146, anticorps cation channel sperm associated auxiliary subunit delta, anticorps CATSPERD, anticorps Catsperd

Sujet: TMEM146 is a single-pass type I membrane protein. The functions of TMEM146 remain unknown.

Poids moléculaire: 90 kDa (MW of target protein)