Pannexin 3 anticorps (Middle Region)

N° du produit ABIN635645

L’anticorps Lapin Polyclonal anti-Pannexin 3 a été validé pour WB. Il convient pour détecter Pannexin 3 dans des échantillons de Mammifères.

Aperçu rapide pour Pannexin 3 anticorps (Middle Region) (ABIN635645)

Antigène: Pannexin 3 (PANX3)

Reactivité: Mammifères

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Pannexin 3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Pannexin 3 anticorps

Épitope: Middle Region

Specificité: Pannexin 3 antibody was raised against the middle region of PANX3

Réactivité croisée: Humain, Souris, Rat (Rattus)

Purification: Affinity purified

Immunogène: Pannexin 3 antibody was raised using the middle region of PANX3 corresponding to a region with amino acids IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Pannexin 3 Blocking Peptide, (ABIN939394), is also available for use as a blocking control in assays to test for specificity of this Pannexin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Pannexin 3

Antigène: Pannexin 3 (PANX3)

Autre désignation: Pannexin 3

Sujet: The protein encoded by this gene belongs to the innexin family. Innexin family members are known to be the structural components of gap junctions.

Poids moléculaire: 45 kDa (MW of target protein)