STOML3 anticorps

N° du produit ABIN635649

Cet anticorps anti-STOML3 est un anticorps Lapin Polyclonal détectant STOML3 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour STOML3 anticorps (ABIN635649)

Antigène: STOML3 (Stomatin (EPB72)-Like 3 (STOML3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STOML3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-STOML3 anticorps

Purification: Affinity purified

Immunogène: STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STOML3 Blocking Peptide, (ABIN5616443), is also available for use as a blocking control in assays to test for specificity of this STOML3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STOML3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STOML3

Antigène: STOML3 (Stomatin (EPB72)-Like 3 (STOML3))

Autre désignation: STOML3

Sujet: The function of STOML3 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 32 kDa (MW of target protein)