FLJ90709 (Middle Region) anticorps

N° du produit ABIN635655

Cet anticorps anti- est un anticorps Lapin Polyclonal détectant dans WB. Adapté pour Humain.

Aperçu rapide pour FLJ90709 (Middle Region) anticorps (ABIN635655)

Antigène: FLJ90709

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: Middle Region

Specificité: FLJ90709 antibody was raised against the middle region of Flj90709

Purification: Affinity purified

Immunogène: FLJ90709 antibody was raised using the middle region of Flj90709 corresponding to a region with amino acids VLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLJ90709 Blocking Peptide, (ABIN5613618), is also available for use as a blocking control in assays to test for specificity of this FLJ90709 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ90709 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: FLJ90709

Sujet: The function of FLJ90709 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 64 kDa (MW of target protein)