P4HTM anticorps (Middle Region)

N° du produit ABIN635662

Cet anticorps Lapin Polyclonal détecte spécifiquement P4HTM dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour P4HTM anticorps (Middle Region) (ABIN635662)

Antigène: P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp P4HTM est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-P4HTM anticorps

Épitope: Middle Region

Specificité: PH4 antibody was raised against the middle region of PH-4

Purification: Affinity purified

Immunogène: PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids GHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PH4 Blocking Peptide, (ABIN938707), is also available for use as a blocking control in assays to test for specificity of this PH4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PH-4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur P4HTM

Antigène: P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))

Autre désignation: PH4

Sujet: The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia.

Poids moléculaire: 57 kDa (MW of target protein)