EPSTI1 anticorps

N° du produit ABIN635669

L’anticorps anti-EPSTI1 Polyclonal Lapin est utilisé pour la détection de EPSTI1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour EPSTI1 anticorps (ABIN635669)

Antigène: EPSTI1 (Epithelial Stromal Interaction 1 (Breast) (EPSTI1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPSTI1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EPSTI1 anticorps

Purification: Affinity purified

Immunogène: EPSTI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EPSTI1 Blocking Peptide, (ABIN5613390), is also available for use as a blocking control in assays to test for specificity of this EPSTI1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPSTI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EPSTI1

Antigène: EPSTI1 (Epithelial Stromal Interaction 1 (Breast) (EPSTI1))

Autre désignation: EPSTI1

Sujet: EPSTI1 was up-regulated in breast carcinomas. The exact function of EPSTI1 is not known.

Poids moléculaire: 47 kDa (MW of target protein)