TMEM63A anticorps (N-Term)

N° du produit ABIN635671

Cet anticorps Lapin Polyclonal détecte spécifiquement TMEM63A dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour TMEM63A anticorps (N-Term) (ABIN635671)

Antigène: TMEM63A (Transmembrane Protein 63A (TMEM63A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM63A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM63A anticorps

Épitope: N-Term

Specificité: TMEM63 A antibody was raised against the N terminal of TMEM63

Purification: Affinity purified

Immunogène: TMEM63 A antibody was raised using the N terminal of TMEM63 corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM63A Blocking Peptide, (ABIN5616685), is also available for use as a blocking control in assays to test for specificity of this TMEM63A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM63A

Antigène: TMEM63A (Transmembrane Protein 63A (TMEM63A))

Autre désignation: TMEM63A

Sujet: TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.

Poids moléculaire: 89 kDa (MW of target protein)