TMEM63A anticorps (N-Term)

N° du produit ABIN635671

Détail du produit anti-TMEM63A anticorps

Antigène: TMEM63A (Transmembrane Protein 63A (TMEM63A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM63A est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM63 A antibody was raised against the N terminal of TMEM63

Purification: Affinity purified

Immunogène: TMEM63 A antibody was raised using the N terminal of TMEM63 corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM63A Blocking Peptide, catalog no. 33R-5872, is also available for use as a blocking control in assays to test for specificity of this TMEM63A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM63A

Antigène: TMEM63A (Transmembrane Protein 63A (TMEM63A))

Autre désignation: TMEM63A (TMEM63A Produits)

Synonymes: anticorps si:ch211-117l16.1, anticorps KIAA0792, anticorps BC014795, anticorps Tmem64a, anticorps RGD1306829, anticorps Tmem6, anticorps transmembrane protein 63A, anticorps transmembrane protein 63a, anticorps tmem63a, anticorps CpipJ_CPIJ011090, anticorps TMEM63A, anticorps Tmem63a

Sujet: TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.

Poids moléculaire: 89 kDa (MW of target protein)