IGHV5-2 anticorps (N-Term)

N° du produit ABIN635673

Cet anticorps anti-IGHV5-2 est un anticorps Lapin Polyclonal détectant IGHV5-2 dans WB. Adapté pour Humain.

Aperçu rapide pour IGHV5-2 anticorps (N-Term) (ABIN635673)

Antigène: IGHV5-2 (Immunoglobulin Heavy Variable 5-2 (IGHV5-2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Détail du produit anti-IGHV5-2 anticorps

Épitope: N-Term

Specificité: PIGZ antibody was raised against the N terminal of PIGZ

Purification: Affinity purified

Immunogène: PIGZ antibody was raised using the N terminal of PIGZ corresponding to a region with amino acids VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIGZ Blocking Peptide, (ABIN5615374), is also available for use as a blocking control in assays to test for specificity of this PIGZ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGZ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IGHV5-2

Antigène: IGHV5-2 (Immunoglobulin Heavy Variable 5-2 (IGHV5-2))

Autre désignation: IGZ

Sujet: The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. PIGZ is a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.

Poids moléculaire: 63 kDa (MW of target protein)