TMEM63B anticorps (Middle Region)

N° du produit ABIN635674

Détail du produit anti-TMEM63B anticorps

Antigène: TMEM63B (Transmembrane Protein 63B (TMEM63B))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM63B est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM63 B antibody was raised against the middle region of TMEM63

Purification: Affinity purified

Immunogène: TMEM63 B antibody was raised using the middle region of TMEM63 corresponding to a region with amino acids VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM63B Blocking Peptide, catalog no. 33R-9772, is also available for use as a blocking control in assays to test for specificity of this TMEM63B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM63B

Antigène: TMEM63B (Transmembrane Protein 63B (TMEM63B))

Autre désignation: TMEM63B (TMEM63B Produits)

Synonymes: anticorps C6orf110, anticorps RP3-421H19.2, anticorps BC026370, anticorps RGD1305862, anticorps Tmem63b-ps1, anticorps transmembrane protein 63B, anticorps transmembrane protein 63b, anticorps TMEM63B, anticorps Tmem63b

Sujet: TMEM63B belongs to the SPO75/TMEM63 family. It is a multi-pass membrane protein. The function of TMEM63B remains unknown.

Poids moléculaire: 95 kDa (MW of target protein)