TMED4 anticorps (Middle Region)

N° du produit ABIN635682

Cet anticorps anti-TMED4 Polyclonal Lapin (ABIN635682) détecte spécifiquement TMED4 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TMED4 anticorps (Middle Region) (ABIN635682)

Antigène: TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMED4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMED4 anticorps

Épitope: Middle Region

Specificité: TMED4 antibody was raised against the middle region of TMED4

Purification: Affinity purified

Immunogène: TMED4 antibody was raised using the middle region of TMED4 corresponding to a region with amino acids DIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREER

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMED4 Blocking Peptide, (ABIN937390), is also available for use as a blocking control in assays to test for specificity of this TMED4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMED4

Antigène: TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))

Autre désignation: TMED4

Sujet: TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.

Poids moléculaire: 26 kDa (MW of target protein)