RPN1 anticorps (N-Term)

N° du produit ABIN635683

Cet anticorps Lapin Polyclonal détecte spécifiquement RPN1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour RPN1 anticorps (N-Term) (ABIN635683)

Antigène: RPN1 (Ribophorin 1 (RPN1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPN1 anticorps

Épitope: N-Term

Specificité: Ribophorin I antibody was raised against the N terminal of RPN1

Purification: Affinity purified

Immunogène: Ribophorin I antibody was raised using the N terminal of RPN1 corresponding to a region with amino acids TSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ribophorin I Blocking Peptide, (ABIN5615868), is also available for use as a blocking control in assays to test for specificity of this Ribophorin I antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPN1

Antigène: RPN1 (Ribophorin 1 (RPN1))

Autre désignation: Ribophorin I

Sujet: RPN1 is a type I integral membrane protein found only in the rough endoplasmic reticulum. It is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. RPN1 forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome.

Poids moléculaire: 66 kDa (MW of target protein)