Phosphatidylinositol Glycan F (PIGF) (N-Term) anticorps

Détails pour le produit réf. ABIN635684
Antigène
  • pigf
  • zgc:77184
  • phosphatidylinositol glycan anchor biosynthesis class F
  • phosphatidylinositol glycan anchor biosynthesis, class F
  • phosphatidylinositol glycan anchor biosynthesis class F S homeolog
  • PIGF
  • Pigf
  • pigf.S
  • pigf
Épitope
N-Term
6
4
1
Reactivité
Humain
25
17
4
2
1
1
1
1
Hôte
Lapin
26
Clonalité
Polyclonal
Conjugué
Inconjugué
1
1
1
1
1
1
1
Application
Western Blotting (WB)
18
9
9
2
2
1
1
Options
Immunogène PIGF antibody was raised using the N terminal of PIGF corresponding to a region with amino acids MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF
Specificité PIGF antibody was raised against the N terminal of PIGF
Purification Affinity purified
Antigène
Autre désignation PIGF (PIGF Antibody Extrait)
Sujet PIGF is a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. PIGF and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI.
Poids moléculaire 25 kDa (MW of target protein)
Pathways Inositol Metabolic Process
Indications d'application WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Commentaires

PIGF Blocking Peptide, catalog no. 33R-6128, is also available for use as a blocking control in assays to test for specificity of this PIGF antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGF antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images (Fournisseur)
Image no. 1 for anti-Phosphatidylinositol Glycan F (PIGF) (N-Term) antibody (ABIN635684) PIGF antibody used at 1 ug/ml to detect target protein.
Avez-vous cherché autre chose?