LRCH4 anticorps

N° du produit ABIN635689

Détail du produit anti-LRCH4 anticorps

Antigène: LRCH4 (Leucine-Rich Repeats and Calponin Homology (CH) Domain Containing 4 (LRCH4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRCH4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: LRCH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEEAVATGTLNLSNRRLKHFPRGAARSYDLSDITQADLSRNRFPEVPEAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRCH4 Blocking Peptide, catalog no. 33R-4887, is also available for use as a blocking control in assays to test for specificity of this LRCH4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRCH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRCH4

Antigène: LRCH4 (Leucine-Rich Repeats and Calponin Homology (CH) Domain Containing 4 (LRCH4))

Autre désignation: LRCH4 (LRCH4 Produits)

Synonymes: anticorps LRN, anticorps LRRN1, anticorps LRRN4, anticorps PP14183, anticorps 2810008P14Rik, anticorps 2900069C24Rik, anticorps AI558103, anticorps SAP25, anticorps mFLJ00248, anticorps si:dkeyp-73c8.2, anticorps leucine rich repeats and calponin homology domain containing 4, anticorps leucine-rich repeats and calponin homology (CH) domain containing 4, anticorps LRCH4, anticorps Lrch4, anticorps lrch4

Sujet: LRCH4 is a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that this protein resembles a receptor.

Poids moléculaire: 73 kDa (MW of target protein)