ALDH3A2 anticorps (C-Term)

N° du produit ABIN635691

Cet anticorps anti-ALDH3A2 est un anticorps Lapin Polyclonal détectant ALDH3A2 dans WB et IHC. Adapté pour Humain, Rat et Souris.

Aperçu rapide pour ALDH3A2 anticorps (C-Term) (ABIN635691)

Antigène: ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDH3A2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ALDH3A2 anticorps

Épitope: C-Term

Specificité: ALDH3 A2 antibody was raised against the C terminal of ALDH3 2

Purification: Affinity purified

Immunogène: ALDH3 A2 antibody was raised using the C terminal of ALDH3 2 corresponding to a region with amino acids FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDH3A2 Blocking Peptide, (ABIN938319), is also available for use as a blocking control in assays to test for specificity of this ALDH3A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALDH3A2

Antigène: ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))

Autre désignation: ALDH3A2

Sujet: Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This gene product catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid. Mutations in the gene cause Sjogren-Larsson syndrome.

Poids moléculaire: 53 kDa (MW of target protein)