SMPD1 anticorps (Middle Region)

N° du produit ABIN635693

L’anticorps anti-SMPD1 Polyclonal Lapin est utilisé pour la détection de SMPD1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour SMPD1 anticorps (Middle Region) (ABIN635693)

Antigène: SMPD1 (Sphingomyelin phosphodiesterase 1, Acid Lysosomal (SMPD1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMPD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SMPD1 anticorps

Épitope: Middle Region

Specificité: SMPD1 antibody was raised against the middle region of SMPD1

Purification: Affinity purified

Immunogène: SMPD1 antibody was raised using the middle region of SMPD1 corresponding to a region with amino acids INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SMPD1 Blocking Peptide, (ABIN939468), is also available for use as a blocking control in assays to test for specificity of this SMPD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMPD1

Antigène: SMPD1 (Sphingomyelin phosphodiesterase 1, Acid Lysosomal (SMPD1))

Autre désignation: SMPD1

Sujet: SMPD1 is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB).

Poids moléculaire: 65 kDa (MW of target protein)