SEMA4B anticorps (N-Term)

N° du produit ABIN635702

L’anticorps anti-SEMA4B Polyclonal Lapin est utilisé pour la détection de SEMA4B dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour SEMA4B anticorps (N-Term) (ABIN635702)

Antigène: SEMA4B (Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4B (SEMA4B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SEMA4B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SEMA4B anticorps

Épitope: N-Term

Specificité: SEMA4 B antibody was raised against the N terminal of SEMA4

Purification: Affinity purified

Immunogène: SEMA4 B antibody was raised using the N terminal of SEMA4 corresponding to a region with amino acids KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SEMA4B Blocking Peptide, (ABIN939790), is also available for use as a blocking control in assays to test for specificity of this SEMA4B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SEMA4B

Antigène: SEMA4B (Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4B (SEMA4B))

Autre désignation: SEMA4B

Sujet: SEMA4B is a single-pass type I membrane protein. It belongs to the semaphorin family. SEMA4B contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.

Poids moléculaire: 93 kDa (MW of target protein)