UGT8 anticorps (Middle Region)

N° du produit ABIN635705

Détail du produit anti-UGT8 anticorps

Antigène: UGT8 (UDP Glycosyltransferase 8 (UGT8))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGT8 est non-conjugé

Application: Western Blotting (WB)

Specificité: UGT8 antibody was raised against the middle region of µgT8

Purification: Affinity purified

Immunogène: UGT8 antibody was raised using the middle region of µgT8 corresponding to a region with amino acids GILLEWKTVTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGT8 Blocking Peptide, catalog no. 33R-3336, is also available for use as a blocking control in assays to test for specificity of this µgT8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGT8

Antigène: UGT8 (UDP Glycosyltransferase 8 (UGT8))

Autre désignation: UGT8 (UGT8 Produits)

Synonymes: anticorps Xlcgt, anticorps cgt, anticorps ugt4, anticorps AI850488, anticorps AW455908, anticorps Cgt, anticorps Ugt8, anticorps mCerGT, anticorps CGT, anticorps UGT4, anticorps Ugt8a, anticorps UDP glycosyltransferase 8, anticorps UDP galactosyltransferase 8A, anticorps UGT8, anticorps ugt8, anticorps Ugt8a, anticorps Ugt8

Sujet: Galactocerebrosides are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system and are also present in small amounts in kidney. The key enzymatic step in the biosynthesis of galactocerebrosides consists of the transfer of galactose to ceramide catalyzed by UDP-galactose ceramide galactosyltransferase. The enzyme UGT8 is the first involved in complex lipid biosynthesis in the myelinating oligodendrocyte.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization