SLC45A3 anticorps (Middle Region)

N° du produit ABIN635719

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC45A3 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour SLC45A3 anticorps (Middle Region) (ABIN635719)

Antigène: SLC45A3 (Solute Carrier Family 45, Member 3 (SLC45A3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC45A3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC45A3 anticorps

Épitope: Middle Region

Specificité: SLC45 A3 antibody was raised against the middle region of SLC45 3

Purification: Affinity purified

Immunogène: SLC45 A3 antibody was raised using the middle region of SLC45 3 corresponding to a region with amino acids LFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC45A3 Blocking Peptide, (ABIN940344), is also available for use as a blocking control in assays to test for specificity of this SLC45A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC45A3

Antigène: SLC45A3 (Solute Carrier Family 45, Member 3 (SLC45A3))

Autre désignation: SLC45A3

Sujet: SLC45A3 is a multi-pass membrane protein. It belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter family. It is a marker for prostate cells. It may be used, in case of prostate cancers, as a target antigen for protate carcinomas-directed cytotoxic T-cell lymphocytes.

Poids moléculaire: 59 kDa (MW of target protein)