SLC37A1 anticorps

N° du produit ABIN635725

Détail du produit anti-SLC37A1 anticorps

Antigène: SLC37A1 (Solute Carrier Family 37 Member 1 (SLC37A1))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC37A1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC37 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC37A1 Blocking Peptide, catalog no. 33R-5087, is also available for use as a blocking control in assays to test for specificity of this SLC37A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC37A1

Antigène: SLC37A1 (Solute Carrier Family 37 Member 1 (SLC37A1))

Autre désignation: SLC37A1 (SLC37A1 Produits)

Synonymes: anticorps MGC53019, anticorps G3PP, anticorps zgc:101659, anticorps solute carrier family 37 (glucose-6-phosphate transporter), member 1 L homeolog, anticorps solute carrier family 37 member 1, anticorps solute carrier family 37 (glucose-6-phosphate transporter), member 1, anticorps solute carrier family 37 (glycerol-3-phosphate transporter), member 1, anticorps slc37a1.L, anticorps SLC37A1, anticorps Slc37a1, anticorps slc37a1

Sujet: SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.

Poids moléculaire: 58 kDa (MW of target protein)