ACSL4 anticorps (N-Term)

N° du produit ABIN635728

Détail du produit anti-ACSL4 anticorps

Antigène: ACSL4 (Acyl-CoA Synthetase Long-Chain Family Member 4 (ACSL4))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACSL4 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACSL4 antibody was raised against the N terminal of ACSL4

Purification: Affinity purified

Immunogène: ACSL4 antibody was raised using the N terminal of ACSL4 corresponding to a region with amino acids AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACSL4 Blocking Peptide, catalog no. 33R-1307, is also available for use as a blocking control in assays to test for specificity of this ACSL4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACSL4

Antigène: ACSL4 (Acyl-CoA Synthetase Long-Chain Family Member 4 (ACSL4))

Autre désignation: ACSL4 (ACSL4 Produits)

Synonymes: anticorps acsl4, anticorps zgc:66186, anticorps ACSL4, anticorps ACS4, anticorps FACL4, anticorps LACS4, anticorps MRX63, anticorps MRX68, anticorps 9430020A05Rik, anticorps AU018108, anticorps Facl4, anticorps Lacs4, anticorps Acs4, anticorps acs4, anticorps acsl3, anticorps facl4, anticorps lacs4, anticorps mrx63, anticorps mrx68, anticorps T32A16.20, anticorps T32A16_20, anticorps long-chain acyl-CoA synthetase 4, anticorps acyl-CoA synthetase long chain family member 4a, anticorps acyl-CoA synthetase long-chain family member 4, anticorps acyl-CoA synthetase long chain family member 4, anticorps AcsL4, anticorps acyl-CoA synthetase long chain family member 3, anticorps Long-chain-fatty-acid--CoA ligase 4, anticorps acyl-CoA synthetase long-chain family member 4 S homeolog, anticorps AMP-dependent synthetase and ligase family protein, anticorps acsl4a, anticorps ACSL4, anticorps acsL4, anticorps acsl3, anticorps acsl4, anticorps Acsl4, anticorps acsl4.S, anticorps LACS4

Sujet: ACSL4 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates 2 transcript variants.

Poids moléculaire: 74 kDa (MW of target protein)