SLC29A2 anticorps

N° du produit ABIN635738

L’anticorps anti-SLC29A2 Polyclonal Lapin est utilisé pour la détection de SLC29A2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour SLC29A2 anticorps (ABIN635738)

Antigène: SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC29A2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC29A2 anticorps

Purification: Affinity purified

Immunogène: SLC29 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC29A2 Blocking Peptide, (ABIN5616234), is also available for use as a blocking control in assays to test for specificity of this SLC29A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC29A2

Antigène: SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))

Autre désignation: SLC29A2

Sujet: SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.

Poids moléculaire: 50 kDa (MW of target protein)