SLC35A5 anticorps (N-Term)

N° du produit ABIN635739

Cet anticorps anti-SLC35A5 est un anticorps Lapin Polyclonal détectant SLC35A5 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour SLC35A5 anticorps (N-Term) (ABIN635739)

Antigène: SLC35A5 (Solute Carrier Family 35, Member A5 (SLC35A5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC35A5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC35A5 anticorps

Épitope: N-Term

Specificité: SLC35 A5 antibody was raised against the N terminal of SLC35 5

Purification: Affinity purified

Immunogène: SLC35 A5 antibody was raised using the N terminal of SLC35 5 corresponding to a region with amino acids LVKYSANEENKYDYLPTTVNVCSELVKLVFCVLVSFCVIKKDHQSRNLKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC35A5 Blocking Peptide, (ABIN5616236), is also available for use as a blocking control in assays to test for specificity of this SLC35A5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC35A5

Antigène: SLC35A5 (Solute Carrier Family 35, Member A5 (SLC35A5))

Autre désignation: SLC35A5

Sujet: SLC35A5 belongs to the nucleotide-sugar transporter family, SLC35A subfamily. It is a multi-pass membrane protein. The function of the SLC35A5 protein remains unknown.

Poids moléculaire: 48 kDa (MW of target protein)