CHST13 anticorps

N° du produit ABIN635744

L’anticorps anti-CHST13 Polyclonal Lapin est utilisé pour la détection de CHST13 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour CHST13 anticorps (ABIN635744)

Antigène: CHST13 (Carbohydrate (Chondroitin 4) Sulfotransferase 13 (CHST13))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHST13 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CHST13 anticorps

Purification: Affinity purified

Immunogène: CHST13 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHST13 Blocking Peptide, (ABIN936722), is also available for use as a blocking control in assays to test for specificity of this CHST13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHST13

Antigène: CHST13 (Carbohydrate (Chondroitin 4) Sulfotransferase 13 (CHST13))

Autre désignation: CHST13

Sujet: CHST13 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process