LRRTM1 anticorps (Middle Region)

N° du produit ABIN635752

Détail du produit anti-LRRTM1 anticorps

Antigène: LRRTM1 (Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRTM1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRTM1 antibody was raised against the middle region of LRRTM1

Purification: Affinity purified

Immunogène: LRRTM1 antibody was raised using the middle region of LRRTM1 corresponding to a region with amino acids RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRTM1 Blocking Peptide, catalog no. 33R-7965, is also available for use as a blocking control in assays to test for specificity of this LRRTM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRTM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRTM1

Antigène: LRRTM1 (Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1))

Autre désignation: LRRTM1 (LRRTM1 Produits)

Synonymes: anticorps im:6904481, anticorps 4632401D06Rik, anticorps AW125451, anticorps leucine rich repeat transmembrane neuronal 1, anticorps lrrtm1, anticorps LRRTM1, anticorps Lrrtm1

Sujet: LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: Synaptic Membrane