Tetraspanin 5 anticorps (Middle Region)

N° du produit ABIN635758

Cet anticorps Lapin Polyclonal détecte spécifiquement Tetraspanin 5 dans WB et IHC. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour Tetraspanin 5 anticorps (Middle Region) (ABIN635758)

Antigène: Tetraspanin 5 (TSPAN5)

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tetraspanin 5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Tetraspanin 5 anticorps

Épitope: Middle Region

Specificité: Tetraspanin 5 antibody was raised against the middle region of TSPAN5

Purification: Affinity purified

Immunogène: Tetraspanin 5 antibody was raised using the middle region of TSPAN5 corresponding to a region with amino acids ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 5 Blocking Peptide, (ABIN936912), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tetraspanin 5

Antigène: Tetraspanin 5 (TSPAN5)

Autre désignation: Tetraspanin 5

Sujet: TSPAN5 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Poids moléculaire: 30 kDa (MW of target protein)