Tetraspanin 5 anticorps (Middle Region)
-
- Antigène Voir toutes Tetraspanin 5 (TSPAN5) Anticorps
- Tetraspanin 5 (TSPAN5)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Tetraspanin 5 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- Tetraspanin 5 antibody was raised against the middle region of TSPAN5
- Purification
- Affinity purified
- Immunogène
- Tetraspanin 5 antibody was raised using the middle region of TSPAN5 corresponding to a region with amino acids ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ
- Top Product
- Discover our top product TSPAN5 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Tetraspanin 5 Blocking Peptide, catalog no. 33R-1526, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Tetraspanin 5 (TSPAN5)
- Autre désignation
- Tetraspanin 5 (TSPAN5 Produits)
- Synonymes
- anticorps net4, anticorps net-4, anticorps tm4sf9, anticorps tspan-5, anticorps MGC84872, anticorps tspan5, anticorps zgc:103404, anticorps MGC145322, anticorps NET-4, anticorps NET4, anticorps TM4SF9, anticorps TSPAN-5, anticorps 2810455A09Rik, anticorps 4930505M03Rik, anticorps AU024142, anticorps Tm4sf9, anticorps Tspan-5, anticorps tetraspanin 5 S homeolog, anticorps tetraspanin 5, anticorps tetraspanin 5a, anticorps tetraspanin-3, anticorps tetraspanin 5 L homeolog, anticorps tspan5.S, anticorps TSPAN5, anticorps tspan5a, anticorps LOC725690, anticorps tspan5, anticorps tspan5.L, anticorps Tspan5
- Sujet
- TSPAN5 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
- Poids moléculaire
- 30 kDa (MW of target protein)
-