TSPAN31 anticorps (Middle Region)

N° du produit ABIN635760

Détail du produit anti-TSPAN31 anticorps

Antigène: TSPAN31 (Tetraspanin 31 (TSPAN31))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSPAN31 est non-conjugé

Application: Western Blotting (WB)

Specificité: Tetraspanin 31 antibody was raised against the middle region of TSPAN31

Purification: Affinity purified

Immunogène: Tetraspanin 31 antibody was raised using the middle region of TSPAN31 corresponding to a region with amino acids CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 31 Blocking Peptide, catalog no. 33R-1819, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 31 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSPAN31

Antigène: TSPAN31 (Tetraspanin 31 (TSPAN31))

Autre désignation: Tetraspanin 31 (TSPAN31 Produits)

Synonymes: anticorps SAS, anticorps 2700085A14Rik, anticorps AW742554, anticorps Sas, anticorps tspan31, anticorps zgc:56710, anticorps sas, anticorps tetraspanin 31, anticorps tetraspanin 31 L homeolog, anticorps tetraspanin 31 S homeolog, anticorps TSPAN31, anticorps Tspan31, anticorps tspan31, anticorps tspan31.L, anticorps tspan31.S

Sujet: TSPAN31 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.

Poids moléculaire: 23 kDa (MW of target protein)