TSPAN12 anticorps (Middle Region)

N° du produit ABIN635761

Cet anticorps Lapin Polyclonal détecte spécifiquement TSPAN12 dans WB. Il présente une réactivité envers Humain, Rat, Souris et Chien.

Aperçu rapide pour TSPAN12 anticorps (Middle Region) (ABIN635761)

Antigène: TSPAN12 (Tetraspanin 12 (TSPAN12))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSPAN12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TSPAN12 anticorps

Épitope: Middle Region

Specificité: Tetraspanin 12 antibody was raised against the middle region of TSPAN12

Purification: Affinity purified

Immunogène: Tetraspanin 12 antibody was raised using the middle region of TSPAN12 corresponding to a region with amino acids EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 12 Blocking Peptide, (ABIN937796), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSPAN12

Antigène: TSPAN12 (Tetraspanin 12 (TSPAN12))

Autre désignation: Tetraspanin 12

Sujet: TSPAN12 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Poids moléculaire: 35 kDa (MW of target protein)