HAVCR1 anticorps (N-Term)

N° du produit ABIN635773

Détail du produit anti-HAVCR1 anticorps

Antigène: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Épitope: N-Term

Reactivité: Hepatitis A Virus (HAV)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAVCR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: HAVCR1 antibody was raised against the N terminal of HAVCR1

Purification: Affinity purified

Immunogène: HAVCR1 antibody was raised using the N terminal of HAVCR1 corresponding to a region with amino acids CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAVCR1 Blocking Peptide, catalog no. 33R-1716, is also available for use as a blocking control in assays to test for specificity of this HAVCR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAVCR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HAVCR1

Antigène: HAVCR1 (Hepatitis A Virus Cellular Receptor 1 (HAVCR1))

Autre désignation: HAVCR1 (HAVCR1 Produits)

Synonymes: anticorps HAVCR, anticorps HAVCR-1, anticorps KIM-1, anticorps KIM1, anticorps TIM, anticorps TIM-1, anticorps TIM1, anticorps TIMD-1, anticorps TIMD1, anticorps Kim1, anticorps HAVCR1, anticorps LOC100226241, anticorps AI503787, anticorps Tim1, anticorps Timd1, anticorps hepatitis A virus cellular receptor 1, anticorps hepatitis A virus cellular receptor 1 homolog, anticorps HAVCR1, anticorps Havcr1, anticorps LOC100226241

Classe de substances: Virus

Sujet: HAVCR1 may play a role in T-helper cell development and the regulation of asthma and allergic diseases. HAVCR1 is the receptor for TIMD4. In case of human hepatitis A virus (HHAV) infection, it functions as a cell-surface receptor for the virus.

Poids moléculaire: 39 kDa (MW of target protein)