UGT2A3 anticorps (Middle Region)
-
- Antigène Voir toutes UGT2A3 Anticorps
- UGT2A3 (UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UGT2A3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UGT2 A3 antibody was raised against the middle region of µgT2 3
- Purification
- Affinity purified
- Immunogène
- UGT2 A3 antibody was raised using the middle region of µgT2 3 corresponding to a region with amino acids GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR
- Top Product
- Discover our top product UGT2A3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UGT2A3 Blocking Peptide, catalog no. 33R-3348, is also available for use as a blocking control in assays to test for specificity of this µgT2A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UGT2A3 (UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3))
- Autre désignation
- UGT2A3 (UGT2A3 Produits)
- Synonymes
- anticorps UGT2A1, anticorps zgc:112491, anticorps 2010321J07Rik, anticorps RGD1308444, anticorps Ugt2a3, anticorps UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus, anticorps UDP glucuronosyltransferase family 2 member A3, anticorps UDP glucuronosyltransferase family 2 member A1 complex locus, anticorps UDP glucuronosyltransferase 2 family, polypeptide A3, anticorps UDP-glucuronosyltransferase 2A3, anticorps UDP-glucuronosyltransferase 2A3-like, anticorps UGT2A1, anticorps UGT2A3, anticorps LOC100351592, anticorps LOC100359229, anticorps ugt2a3, anticorps LOC100596311, anticorps Ugt2a3, anticorps LOC100135631
- Sujet
- UGT2A3 belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.
- Poids moléculaire
- 60 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-