TMTC1 anticorps (Middle Region)

N° du produit ABIN635781

Détail du produit anti-TMTC1 anticorps

Antigène: TMTC1 (Transmembrane and Tetratricopeptide Repeat Containing 1 (TMTC1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMTC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMTC1 antibody was raised against the middle region of TMTC1

Purification: Affinity purified

Immunogène: TMTC1 antibody was raised using the middle region of TMTC1 corresponding to a region with amino acids LFFTKGNQLREQNLLDKAFESYRVAVQLNPDQAQAWMNMGGIQHIKGKYV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMTC1 Blocking Peptide, catalog no. 33R-4937, is also available for use as a blocking control in assays to test for specificity of this TMTC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMTC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMTC1

Antigène: TMTC1 (Transmembrane and Tetratricopeptide Repeat Containing 1 (TMTC1))

Autre désignation: TMTC1 (TMTC1 Produits)

Synonymes: anticorps OLF, anticorps TMTC1A, anticorps Arg99, anticorps BC023818, anticorps RGD1564868, anticorps transmembrane and tetratricopeptide repeat containing 1, anticorps TMTC1, anticorps Tmtc1

Sujet: TMTC1 is a multi-pass membrane protein. It belongs to the TMTC family and contains 10 TPR repeats. The exact function of TMTC1 remains unknown.

Poids moléculaire: 87 kDa (MW of target protein)