FOLR1 anticorps
-
- Antigène Voir toutes FOLR1 Anticorps
- FOLR1 (Folate Receptor 1 (Adult) (FOLR1))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FOLR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- FOLR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF
- Top Product
- Discover our top product FOLR1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FOLR1 Blocking Peptide, catalog no. 33R-3731, is also available for use as a blocking control in assays to test for specificity of this FOLR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FOLR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FOLR1 (Folate Receptor 1 (Adult) (FOLR1))
- Autre désignation
- FOLR1 (FOLR1 Produits)
- Synonymes
- anticorps FBP, anticorps FOLR, anticorps fbp, anticorps folr, anticorps folr1, anticorps FBP1, anticorps Folbp-1, anticorps Folbp1, anticorps Fbp1, anticorps FOLR1, anticorps Folr1, anticorps folate receptor 1, anticorps folate receptor 1 (adult), anticorps folate receptor 1 (adult) L homeolog, anticorps zgc:165502, anticorps Folate receptor alpha, anticorps folate receptor alpha, anticorps FOLR1, anticorps folr1, anticorps folr1.L, anticorps zgc:165502, anticorps Folr1, anticorps LOC100066084, anticorps LOC100725439
- Sujet
- The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells.
- Poids moléculaire
- 27 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-