FOLR1 anticorps

N° du produit ABIN635782

Cet anticorps Lapin Polyclonal détecte spécifiquement FOLR1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour FOLR1 anticorps (ABIN635782)

Antigène: FOLR1 (Folate Receptor 1 (Adult) (FOLR1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FOLR1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FOLR1 anticorps

Purification: Affinity purified

Immunogène: FOLR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FOLR1 Blocking Peptide, (ABIN939117), is also available for use as a blocking control in assays to test for specificity of this FOLR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FOLR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FOLR1

Antigène: FOLR1 (Folate Receptor 1 (Adult) (FOLR1))

Autre désignation: FOLR1

Sujet: The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport