ADAM19 anticorps

N° du produit ABIN635789

Détail du produit anti-ADAM19 anticorps

Antigène: ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAM19 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADAM19 Blocking Peptide, catalog no. 33R-3525, is also available for use as a blocking control in assays to test for specificity of this ADAM19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADAM19

Antigène: ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))

Autre désignation: ADAM19 (Adam19 Produits)

Synonymes: anticorps AL024287, anticorps M[b], anticorps Mltnb, anticorps MADDAM, anticorps MLTNB, anticorps Sox30, anticorps fksg34, anticorps maddam, anticorps mltnb, anticorps a disintegrin and metallopeptidase domain 19 (meltrin beta), anticorps ADAM metallopeptidase domain 19, anticorps ADAM metallopeptidase domain 19 S homeolog, anticorps Adam19, anticorps ADAM19, anticorps adam19.S

Sujet: ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation.

Poids moléculaire: 82 kDa (MW of target protein)