TBL2 anticorps

N° du produit ABIN635791

Détail du produit anti-TBL2 anticorps

Antigène: TBL2 (Transducin (Beta)-Like 2 (TBL2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBL2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBL2 Blocking Peptide, catalog no. 33R-8181, is also available for use as a blocking control in assays to test for specificity of this TBL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBL2

Antigène: TBL2 (Transducin (Beta)-Like 2 (TBL2))

Autre désignation: TBL2 (TBL2 Produits)

Synonymes: anticorps wu:fa96f08, anticorps tbl2, anticorps MGC53692, anticorps TBL2, anticorps MGC79804, anticorps MGC140759, anticorps DKFZp469O1728, anticorps WBSCR13, anticorps WS-betaTRP, anticorps C76179, anticorps WS-bTRP, anticorps transducin (beta)-like 2, anticorps transducin (beta)-like 2 L homeolog, anticorps transducin beta like 2, anticorps tbl2, anticorps tbl2.L, anticorps TBL2, anticorps Tbl2

Sujet: TBL2 is a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.

Poids moléculaire: 49 kDa (MW of target protein)