UQCR10 anticorps

N° du produit ABIN635794

Cet anticorps Lapin Polyclonal détecte spécifiquement UQCR10 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour UQCR10 anticorps (ABIN635794)

Antigène: UQCR10 (Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UQCR10 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UQCR10 anticorps

Purification: Affinity purified

Immunogène: UCRC antibody was raised using a synthetic peptide corresponding to a region with amino acids LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UCRC Blocking Peptide, (ABIN940332), is also available for use as a blocking control in assays to test for specificity of this UCRC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCRC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UQCR10

Antigène: UQCR10 (Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10))

Autre désignation: UCRC

Sujet: UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase, EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.

Poids moléculaire: 7 kDa (MW of target protein)