UQCR10 anticorps
-
- Antigène Voir toutes UQCR10 Anticorps
- UQCR10 (Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UQCR10 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- UCRC antibody was raised using a synthetic peptide corresponding to a region with amino acids LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
- Top Product
- Discover our top product UQCR10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UCRC Blocking Peptide, catalog no. 33R-4946, is also available for use as a blocking control in assays to test for specificity of this UCRC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCRC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UQCR10 (Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10))
- Autre désignation
- UCRC (UQCR10 Produits)
- Synonymes
- anticorps Ucrc, anticorps UCRC, anticorps qcr9, anticorps ucrc, anticorps HSPC051, anticorps HSPC151, anticorps QCR9, anticorps UCCR7.2, anticorps 1110020P15Rik, anticorps AA960494, anticorps ubiquinol-cytochrome c reductase, complex III subunit X, anticorps ubiquinol-cytochrome c reductase complex 7.2 kDa protein, anticorps ubiquinol-cytochrome c reductase, complex III subunit X L homeolog, anticorps Uqcr10, anticorps UQCR10, anticorps uqcr10.L
- Sujet
- UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase, EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.
- Poids moléculaire
- 7 kDa (MW of target protein)
-