CEACAM4 anticorps (N-Term)

N° du produit ABIN635809

Cet anticorps Lapin Polyclonal détecte spécifiquement CEACAM4 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour CEACAM4 anticorps (N-Term) (ABIN635809)

Antigène: CEACAM4 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 4 (CEACAM4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CEACAM4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CEACAM4 anticorps

Épitope: N-Term

Specificité: CEACAM4 antibody was raised against the N terminal of CEACAM4

Purification: Affinity purified

Immunogène: CEACAM4 antibody was raised using the N terminal of CEACAM4 corresponding to a region with amino acids FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CEACAM4 Blocking Peptide, (ABIN938478), is also available for use as a blocking control in assays to test for specificity of this CEACAM4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CEACAM4

Antigène: CEACAM4 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 4 (CEACAM4))

Autre désignation: CEACAM4

Sujet: CEACAM4 belongs to the immunoglobulin superfamily.

Poids moléculaire: 26 kDa (MW of target protein)