CEACAM4 anticorps (N-Term)
-
- Antigène Voir toutes CEACAM4 Anticorps
- CEACAM4 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 4 (CEACAM4))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CEACAM4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CEACAM4 antibody was raised against the N terminal of CEACAM4
- Purification
- Affinity purified
- Immunogène
- CEACAM4 antibody was raised using the N terminal of CEACAM4 corresponding to a region with amino acids FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITD
- Top Product
- Discover our top product CEACAM4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CEACAM4 Blocking Peptide, catalog no. 33R-3092, is also available for use as a blocking control in assays to test for specificity of this CEACAM4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CEACAM4 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 4 (CEACAM4))
- Autre désignation
- CEACAM4 (CEACAM4 Produits)
- Synonymes
- anticorps CGM7, anticorps CGM7_HUMAN, anticorps NCA, anticorps carcinoembryonic antigen related cell adhesion molecule 4, anticorps carcinoembryonic antigen-related cell adhesion molecule 4, anticorps CEACAM4, anticorps LOC456061, anticorps Ceacam4
- Sujet
- CEACAM4 belongs to the immunoglobulin superfamily.
- Poids moléculaire
- 26 kDa (MW of target protein)
-