Receptor Accessory Protein 1 anticorps (Middle Region)
-
- Antigène Voir toutes Receptor Accessory Protein 1 (REEP1) Anticorps
- Receptor Accessory Protein 1 (REEP1)
-
Épitope
- Middle Region
-
Reactivité
- Souris, Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Receptor Accessory Protein 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- REEP1 antibody was raised against the middle region of REEP1
- Purification
- Affinity purified
- Immunogène
- REEP1 antibody was raised using the middle region of REEP1 corresponding to a region with amino acids AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI
- Top Product
- Discover our top product REEP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
REEP1 Blocking Peptide, catalog no. 33R-1288, is also available for use as a blocking control in assays to test for specificity of this REEP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REEP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Receptor Accessory Protein 1 (REEP1)
- Autre désignation
- REEP1 (REEP1 Produits)
- Synonymes
- anticorps C2orf23, anticorps HMN5B, anticorps SPG31, anticorps D6Ertd253e, anticorps RGD1305230, anticorps receptor accessory protein 1, anticorps REEP1, anticorps Reep1
- Sujet
- REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.
- Poids moléculaire
- 22 kDa (MW of target protein)
-