TIM3 anticorps (N-Term)

N° du produit ABIN635817

Cet anticorps anti-TIM3 est un anticorps Lapin Polyclonal détectant TIM3 dans WB. Adapté pour Hepatitis A Virus (HAV).

Aperçu rapide pour TIM3 anticorps (N-Term) (ABIN635817)

Antigène: TIM3 (TIM 3) (Hepatitis A Virus Cellular Receptor 2 (TIM 3))

Reactivité: Hepatitis A Virus (HAV)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TIM3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TIM3 anticorps

Épitope: N-Term

Specificité: HAVCR2 antibody was raised against the N terminal of HAVCR2

Purification: Affinity purified

Immunogène: HAVCR2 antibody was raised using the N terminal of HAVCR2 corresponding to a region with amino acids MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAVCR2 Blocking Peptide, (ABIN5613935), is also available for use as a blocking control in assays to test for specificity of this HAVCR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAVCR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TIM3

Antigène: TIM3 (TIM 3) (Hepatitis A Virus Cellular Receptor 2 (TIM 3))

Autre désignation: HAVCR2

Classe de substances: Virus

Sujet: HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha, Cancer Immune Checkpoints