Tspan-8 anticorps (Middle Region)

N° du produit ABIN635820

Détail du produit anti-Tspan-8 anticorps

Antigène: Tspan-8 (TSPAN8) (Tetraspanin 8 (TSPAN8))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tspan-8 est non-conjugé

Application: Western Blotting (WB)

Specificité: Tetraspanin 8 antibody was raised against the middle region of TSPAN8

Purification: Affinity purified

Immunogène: Tetraspanin 8 antibody was raised using the middle region of TSPAN8 corresponding to a region with amino acids VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 8 Blocking Peptide, catalog no. 33R-9530, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tspan-8

Antigène: Tspan-8 (TSPAN8) (Tetraspanin 8 (TSPAN8))

Autre désignation: Tetraspanin 8 (TSPAN8 Produits)

Synonymes: anticorps tm4sf3, anticorps MGC64550, anticorps GB13255, anticorps TM4SF3, anticorps tetraspanin-8, anticorps tspan8, anticorps TSPAN8, anticorps CO-029, anticorps C76990, anticorps E330007O21Rik, anticorps Tm4sf3, anticorps CO-29, anticorps TSPAN-8, anticorps tetraspanin 8 L homeolog, anticorps tetraspanin-1, anticorps tetraspanin 8, anticorps tspan8.L, anticorps LOC409511, anticorps TSPAN8, anticorps tspan8, anticorps Tspan8

Sujet: TSPAN8 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN8 is a cell surface glycoprotein that is known to complex with integrins. TSPAN8 is expressed in different carcinomas.

Poids moléculaire: 26 kDa (MW of target protein)