BRI3BP anticorps (C-Term)

N° du produit ABIN635825

L’anticorps Lapin Polyclonal anti-BRI3BP a été validé pour WB. Il convient pour détecter BRI3BP dans des échantillons de Humain.

Aperçu rapide pour BRI3BP anticorps (C-Term) (ABIN635825)

Antigène: BRI3BP (BRI3 Binding Protein (BRI3BP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BRI3BP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BRI3BP anticorps

Épitope: C-Term

Specificité: BRI3 BP antibody was raised against the C terminal of BRI3 P

Purification: Affinity purified

Immunogène: BRI3 BP antibody was raised using the C terminal of BRI3 P corresponding to a region with amino acids GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BRI3BP Blocking Peptide, (ABIN938656), is also available for use as a blocking control in assays to test for specificity of this BRI3BP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRI0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BRI3BP

Antigène: BRI3BP (BRI3 Binding Protein (BRI3BP))

Autre désignation: BRI3BP

Sujet: BRI3BP is involved in the structural dynamics of the ER and affects mitochondrial viability.It is widely expressed in animal cell types, that seems to possess a pro-apoptotic property and can potentiate drug-induced apoptosis.

Poids moléculaire: 28 kDa (MW of target protein)