GPD2 anticorps

N° du produit ABIN635827

Détail du produit anti-GPD2 anticorps

Antigène: GPD2 (Glycerol Phosphate Dehydrogenase 2, Mitochondrial (GPD2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPD2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPD2 Blocking Peptide, catalog no. 33R-3516, is also available for use as a blocking control in assays to test for specificity of this GPD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPD2

Antigène: GPD2 (Glycerol Phosphate Dehydrogenase 2, Mitochondrial (GPD2))

Autre désignation: GPD2 (GPD2 Produits)

Synonymes: anticorps glycerol-3-phosphate dehydrogenase Gpd2, anticorps gpd2

Sujet: The protein encoded by this gene localizes to the inner mitochondrial membrane and catalyzes the conversion of glycerol-3-phosphate to dihydroxyacetone phosphate, using FAD as a cofactor.

Poids moléculaire: 81 kDa (MW of target protein)