PTGIS anticorps

N° du produit ABIN635828

L’anticorps Lapin Polyclonal anti-PTGIS a été validé pour WB. Il convient pour détecter PTGIS dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PTGIS anticorps (ABIN635828)

Antigène: PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTGIS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PTGIS anticorps

Purification: Affinity purified

Immunogène: PTGIS antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTGIS Blocking Peptide, (ABIN937879), is also available for use as a blocking control in assays to test for specificity of this PTGIS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGIS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTGIS

Antigène: PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))

Autre désignation: PTGIS

Sujet: PTGIS is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity.

Poids moléculaire: 57 kDa (MW of target protein)