PTGIS anticorps

N° du produit ABIN635828

Détail du produit anti-PTGIS anticorps

Antigène: PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTGIS est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PTGIS antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTGIS Blocking Peptide, catalog no. 33R-2493, is also available for use as a blocking control in assays to test for specificity of this PTGIS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGIS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTGIS

Antigène: PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))

Autre désignation: PTGIS (PTGIS Produits)

Synonymes: anticorps CYP8, anticorps CYP8A1, anticorps PGIS, anticorps PTGI, anticorps Cyp8, anticorps Cyp8a1, anticorps Pgis, anticorps ptgisl, anticorps PTGIS, anticorps prostaglandin I2 synthase, anticorps prostaglandin I2 (prostacyclin) synthase, anticorps prostacyclin synthase, anticorps PTGIS, anticorps Ptgis, anticorps ptgis, anticorps VDBG_06319

Sujet: PTGIS is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity.

Poids moléculaire: 57 kDa (MW of target protein)