IGF-like family receptor 1 (IGFLR1) (N-Term) anticorps

N° du produit ABIN635834

Détail du produit

Antigène: IGF-like family receptor 1 (IGFLR1)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: TMEM149 antibody was raised against the N terminal of TMEM149

Purification: Affinity purified

Immunogène: TMEM149 antibody was raised using the N terminal of TMEM149 corresponding to a region with amino acids WRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM149 Blocking Peptide, catalog no. 33R-9996, is also available for use as a blocking control in assays to test for specificity of this TMEM149 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM149 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: IGF-like family receptor 1 (IGFLR1)

Autre désignation: TMEM149 (IGFLR1 Produits)

Sujet: TMEM149 is a single-pass type I membrane protein. The exact function of TMEM149 remains unknown.

Poids moléculaire: 38 kDa (MW of target protein)