NDST4 anticorps

N° du produit ABIN635843

L’anticorps Lapin Polyclonal anti-NDST4 a été validé pour WB. Il convient pour détecter NDST4 dans des échantillons de Humain et Souris.

Aperçu rapide pour NDST4 anticorps (ABIN635843)

Antigène: NDST4 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NDST4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NDST4 anticorps

Purification: Affinity purified

Immunogène: NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NDST4 Blocking Peptide, (ABIN936135), is also available for use as a blocking control in assays to test for specificity of this NDST4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDST4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NDST4

Antigène: NDST4 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4))

Autre désignation: NDST4

Sujet: NDST4 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate.

Poids moléculaire: 101 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process