Membrane transport protein XK (XK) anticorps

N° du produit ABIN635847

Cet anticorps anti-Membrane transport protein XK Polyclonal Lapin (ABIN635847) détecte spécifiquement Membrane transport protein XK dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour Membrane transport protein XK (XK) anticorps (ABIN635847)

Antigène: Membrane transport protein XK (XK)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Purification: Affinity purified

Immunogène: XK antibody was raised using a synthetic peptide corresponding to a region with amino acids QMPKNGLSEEIEKEVGQAEGKLITHRSAFSRASVIQAFLGSAPQLTLQLY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

XK Blocking Peptide, (ABIN5617039), is also available for use as a blocking control in assays to test for specificity of this XK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Membrane transport protein XK (XK)

Autre désignation: XK

Sujet: This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. XK has structural characteristics of prokaryotic and eukaryotic membrane transport proteins. This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx).

Poids moléculaire: 51 kDa (MW of target protein)