TMEM158 anticorps (Middle Region)
-
- Antigène Voir toutes TMEM158 Anticorps
- TMEM158 (Transmembrane Protein 158 (TMEM158))
-
Épitope
- Middle Region
-
Reactivité
- Souris, Rat, Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMEM158 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMEM158 antibody was raised against the middle region of TMEM158
- Purification
- Affinity purified
- Immunogène
- TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR
- Top Product
- Discover our top product TMEM158 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMEM158 Blocking Peptide, catalog no. 33R-1244, is also available for use as a blocking control in assays to test for specificity of this TMEM158 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM158 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMEM158 (Transmembrane Protein 158 (TMEM158))
- Autre désignation
- TMEM158 (TMEM158 Produits)
- Sujet
- TMEM158 is the receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide.
- Poids moléculaire
- 30 kDa (MW of target protein)
-