TMEM158 anticorps (Middle Region)

N° du produit ABIN635848

Cet anticorps Lapin Polyclonal détecte spécifiquement TMEM158 dans WB. Il présente une réactivité avec des échantillons de Souris, Rat et Humain.

Aperçu rapide pour TMEM158 anticorps (Middle Region) (ABIN635848)

Antigène: TMEM158 (Transmembrane Protein 158 (TMEM158))

Reactivité: Souris, Rat, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM158 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM158 anticorps

Épitope: Middle Region

Specificité: TMEM158 antibody was raised against the middle region of TMEM158

Purification: Affinity purified

Immunogène: TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM158 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TMEM158 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM158 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM158

Antigène: TMEM158 (Transmembrane Protein 158 (TMEM158))

Autre désignation: TMEM158

Sujet: TMEM158 is the receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide.

Poids moléculaire: 30 kDa (MW of target protein)