TMEM158 anticorps (Middle Region)

N° du produit ABIN635848

Détail du produit anti-TMEM158 anticorps

Antigène: TMEM158 (Transmembrane Protein 158 (TMEM158))

Épitope: Middle Region

Reactivité: Souris, Rat, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM158 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM158 antibody was raised against the middle region of TMEM158

Purification: Affinity purified

Immunogène: TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM158 Blocking Peptide, catalog no. 33R-1244, is also available for use as a blocking control in assays to test for specificity of this TMEM158 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM158 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM158

Antigène: TMEM158 (Transmembrane Protein 158 (TMEM158))

Autre désignation: TMEM158 (TMEM158 Produits)

Sujet: TMEM158 is the receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide.

Poids moléculaire: 30 kDa (MW of target protein)