ST6GALNAC4 anticorps (Middle Region)
-
- Antigène Voir toutes ST6GALNAC4 Anticorps
- ST6GALNAC4 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 4 (ST6GALNAC4))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ST6GALNAC4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ST6 GALNAC4 antibody was raised against the middle region of ST6 ALNAC4
- Purification
- Affinity purified
- Immunogène
- ST6 GALNAC4 antibody was raised using the middle region of ST6 ALNAC4 corresponding to a region with amino acids QLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMIL
- Top Product
- Discover our top product ST6GALNAC4 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ST6GALNAC4 Blocking Peptide, catalog no. 33R-7650, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ST6GALNAC4 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 4 (ST6GALNAC4))
- Autre désignation
- ST6GALNAC4 (ST6GALNAC4 Produits)
- Sujet
- ST6GALNAC4 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST6GALNAC4 prefers glycoproteins rather than glycolipids as substrates and shows restricted substrate specificity, utilizing only the trisaccharide sequence Neu5Ac-alpha-2,3-Gal-beta-1,3-GalNAc. In addition, it is involved in the synthesis of ganglioside GD1A from GM1B. ST6GALNAC4 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. It is a member of glycosyltransferase family 29.
- Poids moléculaire
- 34 kDa (MW of target protein)
-